Creating a Student-centered Learning Environment

Creating a Student-centered Learning Environment: Implementation of Problem-based Learning to Teach Microbiology to Undergraduate Medical Students.

Introduction Medical schooling includes the coaching essential to develop into a physician or surgeon.

These embrace numerous ranges of coaching of students, interns and graduate coaching. medical schooling might be very advanced because it includes the coaching of pre-clinical topics (anatomy, physiology, biochemistry), topic para-clinical (microbiology, pathology, pharmacology, and forensic medication), and a gaggle of discrete topics of scientific covers basic medication, surgical procedure , obstetrics and gynecology, ear, nostril and throat specialties, pediatrics, cardiology, pulmonology, dermatology, ophthalmology, and orthopedics, and lots of different scientific specialties and tremendous specialties (cardio-thoracic surgical procedure, neurosurgery, and so forth.).


Coaching medical college students includes each classroom instructing and sensible utility. classroom instructing is often restricted to a didactic lecture, through which the instructor unilaterally disseminate data.


Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 662

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 500

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 692

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-48T 48T
EUR 489
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-96T 96T
EUR 635
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 508
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 661
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-48Tests 48 Tests
EUR 489

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-96Tests 96 Tests
EUR 677

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 511

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 709

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 511

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 709

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 534

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 742

Amyloid Beta-Peptide (1-40) (human)

A1124-10 10 mg
EUR 746
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-25 25 mg
EUR 1024
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-5 5 mg
EUR 467
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

abx670346-1mg 1 mg
EUR 523
  • Shipped within 1 week.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit

STJ150127 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

  • EUR 481.00
  • EUR 244.00
  • EUR 1372.00
  • EUR 565.00
  • EUR 342.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

  • EUR 342.00
  • EUR 217.00
  • EUR 899.00
  • EUR 411.00
  • EUR 272.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

  • EUR 606.00
  • EUR 258.00
  • EUR 1817.00
  • EUR 718.00
  • EUR 439.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 425.00
  • EUR 133.00
  • EUR 1177.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 398.00
  • EUR 133.00
  • EUR 1094.00
  • EUR 537.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 411.00
  • EUR 133.00
  • EUR 1135.00
  • EUR 551.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 350.88
  • EUR 197.00
  • EUR 1040.80
  • EUR 413.60
  • EUR 727.20
  • EUR 298.00
  • EUR 2452.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 4329.9Da
  • Isoelectric Point: 5.3
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit

STJ150003 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

  • EUR 342.00
  • EUR 217.00
  • EUR 899.00
  • EUR 411.00
  • EUR 272.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

  • EUR 342.00
  • EUR 217.00
  • EUR 899.00
  • EUR 411.00
  • EUR 272.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.


5-00456 4 x 1mg Ask for price

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 431.52
  • EUR 218.00
  • EUR 1343.20
  • EUR 514.40
  • EUR 928.80
  • EUR 352.00
  • EUR 3208.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 341.02
  • EUR 194.00
  • EUR 1003.84
  • EUR 401.28
  • EUR 702.56
  • EUR 291.00
  • EUR 2359.60
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-10x96wellstestplate 10x96-wells test plate
EUR 4273.35
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x48wellstestplate 1x48-wells test plate
EUR 439.57
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x96wellstestplate 1x96-wells test plate
EUR 585.1
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-5x96wellstestplate 5x96-wells test plate
EUR 2332.95
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 4324.00
  • EUR 2283.00
  • EUR 586.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

ED1031-096 96T
EUR 887

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-48T 48T
EUR 289

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-96T 96T
EUR 466

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 6642.00
  • EUR 3542.00
  • EUR 825.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx053393-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit

  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H1 96T
EUR 454

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H2 48T
EUR 303

Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)

RK00784 96 Tests
EUR 521

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E04414 96T
EUR 361

Human beta-Amyloid 1-40 (full length) peptide

BAM400-P 100 ug
EUR 164

Human beta-Amyloid 1-40 (full length) peptide

BAM400-P1000 1000 ug
EUR 347

Human Beta-Amyloid 1-40 Control/blocking peptide

BAM402-P 100 ug
EUR 164

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864h 96 Tests
EUR 824

Human amyloid beta peptide 1-40,A?1-40 ELISA Kit

201-12-1231 96 tests
EUR 440
  • This amyloid beta peptide 1-40 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

CSB-E08299h-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

  • EUR 900.00
  • EUR 5476.00
  • EUR 2900.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Abeta 40 (beta amyloid 1-40)

RA25009 100 ul
EUR 383

ELISA kit for Human Ab1-40 (Amyloid Beta Peptide 1-40)

ELK1492 1 plate of 96 wells
EUR 432
  • A monoclonal antibody specific to Amyloid Beta Peptide 1-40 (A?1-40) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Amyloid Beta Peptide 1-40 (A?1-40) and unlabeled Amyloid Beta Peptide 1-4
  • Show more
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-10x96wellstestplate 10x96-wells test plate
EUR 4391.16
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x48wellstestplate 1x48-wells test plate
EUR 449.27
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x96wellstestplate 1x96-wells test plate
EUR 598.96
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-5x96wellstestplate 5x96-wells test plate
EUR 2395.32
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 4442.00
  • EUR 2346.00
  • EUR 599.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-10x96wellstestplate 10x96-wells test plate
EUR 4626.78
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x48wellstestplate 1x48-wells test plate
EUR 468.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x96wellstestplate 1x96-wells test plate
EUR 626.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-5x96wellstestplate 5x96-wells test plate
EUR 2520.06
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 4677.00
  • EUR 2471.00
  • EUR 627.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx361651-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx362577-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

ED1032-096 96T
EUR 928

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0318MS-48T 48T
EUR 336

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0318MS-96T 96T
EUR 534

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0029RB-48T 48T
EUR 326

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0029RB-96T 96T
EUR 524

This sort of instructing have just lately famous to be not very efficient in producing certified medical graduates higher. The aim of this research to introduce problem-based studying (PBL) for instructing microbiology to undergraduate medical college students and consider their notion of such varieties of studying.


Strategies A complete of 159 college students are concerned on this analysis. An oral knowledgeable consent was obtained from every participant, and the research was accredited by the institutional ethics committee.

All college students included on this research had been categorized into 14 teams of 11-13 college students. College students are rigorously grouped to make positive that every group has a great combine that included numerous ranges of accomplishment. College students are given an in depth introduction to apply earlier than they begin.


A questionnaire consisting of 11 factors had been awarded to the scholars they usually had been requested to supply suggestions (strongly disagree, disagree, conform to some extent, agree, strongly agree) each in operate and efficiency of lecturers throughout PBL PBL.


Outcomes The research included a complete of 159 college students.

Amongst research members, 55 (35%) had been male and 104 (65%) had been ladies. There was a constructive response to PBL that play a task in bettering cognitive abilities as evidenced by the outcomes (of ladies (59%) and males (29%)) (p = 0.191). We discovered that 61% of ladies and 30% males really feel that PBL is the very best studying methods, in contrast with conventional instructing (p = 0.241).


Most college students are proud of the variety of college students in a gaggle (of ladies (63%) and males (34%)), however some college students really feel that there will likely be enhancements within the studying course of if a smaller group (<10 college students) (p = 0.239 ).

A constructive response was given by college students of the impulse suggestions given by the instructor (feminine (43%) and males (27%)) (p = 0.253).

Analysis of lecturers by college students revealed some fascinating observations, which incorporates an settlement by the majority of the scholars that the tutor was fully averted the normal instructing (ladies (55%), male (32%)) throughout the session PBL (p = 0.001) .

Conclusion Most college students like PBL as a result of it encourages group dialogue and presentation, which helps in sustaining data and enhance cognitive abilities.

 Creating a Student-centered Learning Environment: Implementation of Problem-based Learning to Teach Microbiology to Undergraduate Medical Students.
Making a Pupil-centered Studying Atmosphere: Implementation of Downside-based Studying to Educate Microbiology to Undergraduate Medical College students.

Studying to Write Like a Scientist: A Writing-Intensive Course for Microbiology / Pupil Well being Sciences.

Studying instruments and conventions of communication specialists within the sciences present a number of advantages for college kids Bioscience, however typically these abilities aren’t formally taught. To deal with this want, we designed a write-intensive microbiology programs on infectious ailments to supply upper-division college students with writing skills-specific science programs together with the contents of the self-discipline.

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-00638R2 48T
EUR 332

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0029RB-48T 48T
EUR 326

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0029RB-96T 96T
EUR 524

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-48T 48T
EUR 479
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-96T 96T
EUR 621
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-48T 48T
EUR 489
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-96T 96T
EUR 635
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 508
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 661
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-48Tests 48 Tests
EUR 478

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 662

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-48Tests 48 Tests
EUR 489

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-96Tests 96 Tests
EUR 677

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 511

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 709

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 500

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 692

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 511

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 709

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 534

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 742

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-01866R1 96T
EUR 494

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-02744M1 96T
EUR 461

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-02744M2 48T
EUR 310

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H1 96T
EUR 454

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H2 48T
EUR 303

Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-05164H1 96T
EUR 464

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-48T 48T
EUR 289

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-96T 96T
EUR 466

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0318MS-48T 48T
EUR 336

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0318MS-96T 96T
EUR 534

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0086PC-48T 48T
EUR 364

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0086PC-96T 96T
EUR 590

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0101RT-48T 48T
EUR 317

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0101RT-96T 96T
EUR 496

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E04414 96T
EUR 361

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E11552 96T
EUR 361

Equine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

QY-E120008 96T
EUR 478

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E20080 96T
EUR 361

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Rat amyloid beta peptide 1-40,Aβ1-41 ELISA Kit

CN-01866R2 48T
EUR 344

Horse amyloid beta peptide 1-40,Aβ1-41 ELISA Kit

CN-05164H2 48T
EUR 313

Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx362577-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit

STJ150003 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids

Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit

STJ150127 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864Rb 96 Tests
EUR 928

Rabbit Aβ1-40 ELISA Kit

ERTA0917 96Tests
EUR 521

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

abx670346-1mg 1 mg
EUR 523
  • Shipped within 1 week.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 398.00
  • EUR 133.00
  • EUR 1094.00
  • EUR 537.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 411.00
  • EUR 133.00
  • EUR 1135.00
  • EUR 551.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 425.00
  • EUR 133.00
  • EUR 1177.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 350.88
  • EUR 197.00
  • EUR 1040.80
  • EUR 413.60
  • EUR 727.20
  • EUR 298.00
  • EUR 2452.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 4329.9Da
  • Isoelectric Point: 5.3
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx053393-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 6971.00
  • EUR 3714.00
  • EUR 864.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-10 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 7237.00
  • EUR 3855.00
  • EUR 895.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-10 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 6642.00
  • EUR 3542.00
  • EUR 825.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 6642.00
  • EUR 3542.00
  • EUR 825.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 7237.00
  • EUR 3855.00
  • EUR 895.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx255205-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx256723-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

ED1031-096 96T
EUR 887

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

ED1032-096 96T
EUR 928

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-10x96wellstestplate 10x96-wells test plate
EUR 4273.35
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x48wellstestplate 1x48-wells test plate
EUR 439.57
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x96wellstestplate 1x96-wells test plate
EUR 585.1
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-5x96wellstestplate 5x96-wells test plate
EUR 2332.95
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 4324.00
  • EUR 2283.00
  • EUR 586.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-10x96wellstestplate 10x96-wells test plate
EUR 4391.16
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x48wellstestplate 1x48-wells test plate
EUR 449.27
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x96wellstestplate 1x96-wells test plate
EUR 598.96
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-5x96wellstestplate 5x96-wells test plate
EUR 2395.32
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 4442.00
  • EUR 2346.00
  • EUR 599.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-10x96wellstestplate 10x96-wells test plate
EUR 4626.78
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x48wellstestplate 1x48-wells test plate
EUR 468.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x96wellstestplate 1x96-wells test plate
EUR 626.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-5x96wellstestplate 5x96-wells test plate
EUR 2520.06
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

  • EUR 4677.00
  • EUR 2471.00
  • EUR 627.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx361651-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Monkey Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx353340-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Chicken Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx357155-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)

RK00784 96 Tests
EUR 521

Mouse Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)

RK02558 96 Tests
EUR 521

Rat Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)

RK03455 96 Tests
EUR 521

Rat beta-40(Amyloid Beta 1-40) ELISA Kit

STJ150091 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids

Abeta 40 (beta amyloid 1-40)

RA25009 100 ul
EUR 383

This course follows the pointers of our college program is Writing Intensive Curriculum (WIC). College students write press releases, case research, papers controversy / place, and prospectus grants, and the draft revised after suggestions.

Leave A Comment