Creating a Student-centered Learning Environment

Creating a Student-centered Learning Environment: Implementation of Problem-based Learning to Teach Microbiology to Undergraduate Medical Students.

Introduction Medical schooling includes the coaching essential to develop into a physician or surgeon.

These embrace numerous ranges of coaching of students, interns and graduate coaching. medical schooling might be very advanced because it includes the coaching of pre-clinical topics (anatomy, physiology, biochemistry), topic para-clinical (microbiology, pathology, pharmacology, and forensic medication), and a gaggle of discrete topics of scientific covers basic medication, surgical procedure , obstetrics and gynecology, ear, nostril and throat specialties, pediatrics, cardiology, pulmonology, dermatology, ophthalmology, and orthopedics, and lots of different scientific specialties and tremendous specialties (cardio-thoracic surgical procedure, neurosurgery, and so forth.).

 

Coaching medical college students includes each classroom instructing and sensible utility. classroom instructing is often restricted to a didactic lecture, through which the instructor unilaterally disseminate data.

 

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 830.4

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-48Tests 48 Tests
EUR 573.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 794.4

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)

4-SPA864Hu02
  • EUR 421.06
  • EUR 236.40
  • EUR 1248.96
  • EUR 496.32
  • EUR 872.64
  • EUR 357.60
  • EUR 2942.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 4329.9Da
  • Isoelectric Point: 5.3
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Amyloid Beta-Peptide (1-40) (human)

A1124-10 10 mg
EUR 895.2
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-25 25 mg
EUR 1228.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-5 5 mg
EUR 560.4
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-48T 48T
EUR 586.8
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-96T 96T
EUR 762
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 609.6
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 793.2
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 613.2

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 850.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 640.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 890.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-48Tests 48 Tests
EUR 586.8

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-96Tests 96 Tests
EUR 812.4

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 613.2

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 850.8

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

20-abx652283
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

abx670346-1mg 1 mg
EUR 627.6
  • Shipped within 1 week.

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Hu11
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Hu21
  • EUR 517.82
  • EUR 261.60
  • EUR 1611.84
  • EUR 617.28
  • EUR 1114.56
  • EUR 422.40
  • EUR 3849.60
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Hu23
  • EUR 409.22
  • EUR 232.80
  • EUR 1204.61
  • EUR 481.54
  • EUR 843.07
  • EUR 349.20
  • EUR 2831.52
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Hu31
  • EUR 295.26
  • EUR 202.80
  • EUR 777.22
  • EUR 339.07
  • EUR 558.14
  • EUR 272.40
  • EUR 1763.04
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Mu11
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Mu21
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Mu31
  • EUR 295.26
  • EUR 202.80
  • EUR 777.22
  • EUR 339.07
  • EUR 558.14
  • EUR 272.40
  • EUR 1763.04
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Ra11
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Ra21
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Ra31
  • EUR 295.26
  • EUR 202.80
  • EUR 777.22
  • EUR 339.07
  • EUR 558.14
  • EUR 272.40
  • EUR 1763.04
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit

STJ150127 1 kit
EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

20-abx165634
  • EUR 727.20
  • EUR 309.60
  • EUR 2180.40
  • EUR 861.60
  • EUR 526.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

20-abx651143
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

20-abx651144
  • EUR 577.20
  • EUR 292.80
  • EUR 1646.40
  • EUR 678.00
  • EUR 410.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

20-abx651145
  • EUR 410.40
  • EUR 260.40
  • EUR 1078.80
  • EUR 493.20
  • EUR 326.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08299h
  • EUR 1080.00
  • EUR 6571.20
  • EUR 3480.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx175368
  • EUR 477.60
  • EUR 159.60
  • EUR 1312.80
  • EUR 644.40
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx175369
  • EUR 493.20
  • EUR 159.60
  • EUR 1362.00
  • EUR 661.20
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx132222
  • EUR 510.00
  • EUR 159.60
  • EUR 1412.40
  • EUR 693.60
  • EUR 393.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit

STJ150003 1 kit
EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

20-abx651146
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

20-abx651147
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

20-abx651148
  • EUR 410.40
  • EUR 260.40
  • EUR 1078.80
  • EUR 493.20
  • EUR 326.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

20-abx651149
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

20-abx651150
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

20-abx651151
  • EUR 410.40
  • EUR 260.40
  • EUR 1078.80
  • EUR 493.20
  • EUR 326.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08300m
  • EUR 1135.20
  • EUR 6938.40
  • EUR 3672.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08302r
  • EUR 1160.40
  • EUR 7110.00
  • EUR 3760.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

beta-Amyloid(40-1)

5-00456 4 x 1mg Ask for price

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H1 96T
EUR 544.8

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H2 48T
EUR 363.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-10x96wellstestplate 10x96-wells test plate
EUR 5128.02
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x48wellstestplate 1x48-wells test plate
EUR 527.48
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x96wellstestplate 1x96-wells test plate
EUR 702.12
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-5x96wellstestplate 5x96-wells test plate
EUR 2799.54
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

4-CEA864Hu
  • EUR 5188.80
  • EUR 2739.60
  • EUR 703.20
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx150496
  • EUR 7970.40
  • EUR 4250.40
  • EUR 990.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx053393-96tests 96 tests
EUR 801.6
  • Shipped within 5-12 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit

20-abx490287
  • EUR 9567.60
  • EUR 5095.20
  • EUR 1177.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-48T 48T
EUR 346.8

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-96T 96T
EUR 559.2

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

ED1031-096 96T
EUR 1064.4

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E04414 96T
EUR 433.2

Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)

RK00784 96 Tests
EUR 625.2

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA1751HU-48T 48T
EUR 435

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA1751HU-96T 96T
EUR 562.5

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-192T 192 tests
EUR 1524
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-48 1 plate of 48 wells
EUR 624
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-96 1 plate of 96 wells
EUR 822
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human beta-Amyloid 1-40 (full length) peptide

BAM400-P 100 ug
EUR 196.8

Human beta-Amyloid 1-40 (full length) peptide

BAM400-P1000 1000 ug
EUR 416.4

Human Beta-Amyloid 1-40 Control/blocking peptide

BAM402-P 100 ug
EUR 196.8

Human amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864h 96 Tests
EUR 988.8

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

CSB-E08299h-24T 1 plate of 24 wells
EUR 198
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human amyloid beta peptide 1-40,A?1-40 ELISA Kit

201-12-1231 96 tests
EUR 528
  • This amyloid beta peptide 1-40 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Abeta 40 (beta amyloid 1-40)

RA25009 100 ul
EUR 459.6

ELISA kit for Human Ab1-40 (Amyloid Beta Peptide 1-40)

ELK1492 1 plate of 96 wells
EUR 518.4
  • A monoclonal antibody specific to Amyloid Beta Peptide 1-40 (A?1-40) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Amyloid Beta Peptide 1-40 (A?1-40) and unlabeled Amyloid Beta Peptide 1-4
  • Show more
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-00638R1 96T
EUR 577.2

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-00638R2 48T
EUR 398.4

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-02744M1 96T
EUR 553.2

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-02744M2 48T
EUR 372

Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-05164H1 96T
EUR 556.8

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-10x96wellstestplate 10x96-wells test plate
EUR 5269.39
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x48wellstestplate 1x48-wells test plate
EUR 539.12
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x96wellstestplate 1x96-wells test plate
EUR 718.75
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-5x96wellstestplate 5x96-wells test plate
EUR 2874.38
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

4-CEA864Mu
  • EUR 5330.40
  • EUR 2815.20
  • EUR 718.80
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-10x96wellstestplate 10x96-wells test plate
EUR 5552.14
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x48wellstestplate 1x48-wells test plate
EUR 562.42
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x96wellstestplate 1x96-wells test plate
EUR 752.02
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

This sort of instructing have just lately famous to be not very efficient in producing certified medical graduates higher. The aim of this research to introduce problem-based studying (PBL) for instructing microbiology to undergraduate medical college students and consider their notion of such varieties of studying.

 

Strategies A complete of 159 college students are concerned on this analysis. An oral knowledgeable consent was obtained from every participant, and the research was accredited by the institutional ethics committee.

All college students included on this research had been categorized into 14 teams of 11-13 college students. College students are rigorously grouped to make positive that every group has a great combine that included numerous ranges of accomplishment. College students are given an in depth introduction to apply earlier than they begin.

 

A questionnaire consisting of 11 factors had been awarded to the scholars they usually had been requested to supply suggestions (strongly disagree, disagree, conform to some extent, agree, strongly agree) each in operate and efficiency of lecturers throughout PBL PBL.

 

Outcomes The research included a complete of 159 college students.

Amongst research members, 55 (35%) had been male and 104 (65%) had been ladies. There was a constructive response to PBL that play a task in bettering cognitive abilities as evidenced by the outcomes (of ladies (59%) and males (29%)) (p = 0.191). We discovered that 61% of ladies and 30% males really feel that PBL is the very best studying methods, in contrast with conventional instructing (p = 0.241).

 

Most college students are proud of the variety of college students in a gaggle (of ladies (63%) and males (34%)), however some college students really feel that there will likely be enhancements within the studying course of if a smaller group (<10 college students) (p = 0.239 ).

A constructive response was given by college students of the impulse suggestions given by the instructor (feminine (43%) and males (27%)) (p = 0.253).

Analysis of lecturers by college students revealed some fascinating observations, which incorporates an settlement by the majority of the scholars that the tutor was fully averted the normal instructing (ladies (55%), male (32%)) throughout the session PBL (p = 0.001) .

Conclusion Most college students like PBL as a result of it encourages group dialogue and presentation, which helps in sustaining data and enhance cognitive abilities.

 Creating a Student-centered Learning Environment: Implementation of Problem-based Learning to Teach Microbiology to Undergraduate Medical Students.
Making a Pupil-centered Studying Atmosphere: Implementation of Downside-based Studying to Educate Microbiology to Undergraduate Medical College students.

Studying to Write Like a Scientist: A Writing-Intensive Course for Microbiology / Pupil Well being Sciences.

Studying instruments and conventions of communication specialists within the sciences present a number of advantages for college kids Bioscience, however typically these abilities aren’t formally taught. To deal with this want, we designed a write-intensive microbiology programs on infectious ailments to supply upper-division college students with writing skills-specific science programs together with the contents of the self-discipline.

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-00638R2 48T
EUR 398.4

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0029RB-48T 48T
EUR 391.2

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0029RB-96T 96T
EUR 628.8

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-02744M1 96T
EUR 553.2

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-02744M2 48T
EUR 372

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H1 96T
EUR 544.8

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H2 48T
EUR 363.6

Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-05164H1 96T
EUR 556.8

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-01866R1 96T
EUR 592.8

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0318MS-48T 48T
EUR 403.2

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0318MS-96T 96T
EUR 640.8

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0086PC-48T 48T
EUR 436.8

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0086PC-96T 96T
EUR 708

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0101RT-48T 48T
EUR 380.4

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0101RT-96T 96T
EUR 595.2

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-48T 48T
EUR 346.8

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-96T 96T
EUR 559.2

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E04414 96T
EUR 433.2

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E11552 96T
EUR 433.2

Equine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

QY-E120008 96T
EUR 573.6

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E20080 96T
EUR 433.2

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0171PO-48T 48T
EUR 502.5

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0171PO-96T 96T
EUR 618.75

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0371RA-48T 48T
EUR 465

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0371RA-96T 96T
EUR 600

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0422MO-48T 48T
EUR 465

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0422MO-96T 96T
EUR 600

Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

YLA0030CA-48T 48T
EUR 502.5

Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

YLA0030CA-96T 96T
EUR 618.75

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA1751HU-48T 48T
EUR 435

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA1751HU-96T 96T
EUR 562.5

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-48T 48T
EUR 574.8
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-96T 96T
EUR 745.2
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-48T 48T
EUR 586.8
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-96T 96T
EUR 762
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 609.6
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 793.2
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 600

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 830.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 613.2

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 850.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 640.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 890.4

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-48Tests 48 Tests
EUR 573.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 794.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-48Tests 48 Tests
EUR 586.8

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-96Tests 96 Tests
EUR 812.4

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 613.2

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 850.8

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Horse amyloid beta peptide 1-40,Aβ1-41 ELISA Kit

CN-05164H2 48T
EUR 375.6

Rat amyloid beta peptide 1-40,Aβ1-41 ELISA Kit

CN-01866R2 48T
EUR 412.8

Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx362577-96tests 96 tests
EUR 990
  • Shipped within 5-12 working days.

Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit

STJ150003 1 kit
EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids

Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit

STJ150127 1 kit
EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-192T 192 tests
EUR 1524
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-48 1 plate of 48 wells
EUR 624
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-96 1 plate of 96 wells
EUR 822
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864Rb 96 Tests
EUR 1113.6

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08299h
  • EUR 1080.00
  • EUR 6571.20
  • EUR 3480.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08300m
  • EUR 1135.20
  • EUR 6938.40
  • EUR 3672.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08302r
  • EUR 1160.40
  • EUR 7110.00
  • EUR 3760.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rabbit Aβ1-40 ELISA Kit

ERTA0917 96Tests
EUR 625.2

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

20-abx652283
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

abx670346-1mg 1 mg
EUR 627.6
  • Shipped within 1 week.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx175368
  • EUR 477.60
  • EUR 159.60
  • EUR 1312.80
  • EUR 644.40
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx175369
  • EUR 493.20
  • EUR 159.60
  • EUR 1362.00
  • EUR 661.20
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx132222
  • EUR 510.00
  • EUR 159.60
  • EUR 1412.40
  • EUR 693.60
  • EUR 393.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)

4-SPA864Hu02
  • EUR 421.06
  • EUR 236.40
  • EUR 1248.96
  • EUR 496.32
  • EUR 872.64
  • EUR 357.60
  • EUR 2942.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 4329.9Da
  • Isoelectric Point: 5.3
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-10x96wellstestplate 10x96-wells test plate
EUR 5128.02
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x48wellstestplate 1x48-wells test plate
EUR 527.48
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x96wellstestplate 1x96-wells test plate
EUR 702.12
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-5x96wellstestplate 5x96-wells test plate
EUR 2799.54
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

4-CEA864Hu
  • EUR 5188.80
  • EUR 2739.60
  • EUR 703.20
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-10x96wellstestplate 10x96-wells test plate
EUR 5269.39
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x48wellstestplate 1x48-wells test plate
EUR 539.12
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x96wellstestplate 1x96-wells test plate
EUR 718.75
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-5x96wellstestplate 5x96-wells test plate
EUR 2874.38
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

4-CEA864Mu
  • EUR 5330.40
  • EUR 2815.20
  • EUR 718.80
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-10x96wellstestplate 10x96-wells test plate
EUR 5552.14
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x48wellstestplate 1x48-wells test plate
EUR 562.42
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x96wellstestplate 1x96-wells test plate
EUR 752.02
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-5x96wellstestplate 5x96-wells test plate
EUR 3024.07
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

4-CEA864Ra
  • EUR 5612.40
  • EUR 2965.20
  • EUR 752.40
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx155127
  • EUR 8684.40
  • EUR 4626.00
  • EUR 1074.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx150496
  • EUR 7970.40
  • EUR 4250.40
  • EUR 990.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx153576
  • EUR 7970.40
  • EUR 4250.40
  • EUR 990.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx053393-96tests 96 tests
EUR 801.6
  • Shipped within 5-12 working days.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx053394
  • EUR 8365.20
  • EUR 4456.80
  • EUR 1036.80
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-10 working days.

This course follows the pointers of our college program is Writing Intensive Curriculum (WIC). College students write press releases, case research, papers controversy / place, and prospectus grants, and the draft revised after suggestions.

Leave A Comment