Glp-1 Peptide Apexbio

GLP-2 (human)

B5281-1 1 mg
EUR 438

Apexbio Reagents Laboratories manufactures the glp-1 peptide apexbio reagents distributed by Genprice. The Glp-1 Peptide Apexbio reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact Apexbio Reagents. Other Glp-1 products are available in stock. Specificity: Glp-1 Category: Peptide Group: Apexbio

Anti-Inflammatory Peptide 1

25 mg
EUR 212
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I

Anti-Inflammatory Peptide 1

5 mg
EUR 119
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I

Amyloid ?-Peptide (1-42) (human)

100 ug
EUR 276

HIV-1 Tat Protein Peptide

1 mg
EUR 128
Description: HIV-1 Tat Protein Peptide

HIV-1 Tat Protein Peptide

10 mg
EUR 512
Description: HIV-1 Tat Protein Peptide

Brain natriuretic peptide (1-32) (human)

1 mg
EUR 518

Brain natriuretic peptide (1-32) (human)

10 mg
EUR 2222

Apexbio information

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 235

Glucagon-Like Peptide 2 (GLP-2) AssayMax ELISA Kit

ERG3771-1 96 Well Plate
EUR 477

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

Glucagon-Like Peptide-1 (GLP) Antibody

abx010841-100ul 100 ul
EUR 411
  • Shipped within 5-10 working days.

SAMS Peptide

B5097-1 1 mg
EUR 222

Rhodopsin peptide

A1087-1 1 mg
EUR 131
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light.

C-type natriuretic peptide (1-22) (human, rat, swine)

B5441-1 1 mg
EUR 276

Eledoisin-Related Peptide

B5233-1 1 mg
EUR 155

MLCK inhibitor peptide

B5236-1 1 mg
EUR 184

Lyn peptide inhibitor

B5285-1 1 mg
EUR 601

Compstatin control peptide

B5478-1 1 mg
EUR 373

c-JUN peptide

B9007-1 1 mg
EUR 312

Cadherin Peptide, avian

A1028-1 1 mg
EUR 102
Description: Cadherin Peptide, avian, (C44H75N17O13), a peptide with the sequence Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-NH2, MW= 1050.2. Cadherins (named for "calcium-dependent adhesion") are a class of type-1 transmembrane proteins.

Dynamin inhibitory peptide

A1046-1 1 mg
EUR 189
Description: Dynamin Inhibitory Peptide is a peptide (Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro) inhibitor of the GTPase dynamin.Dynamin is a 100-kDa large GTPase that functions to tabulate membranes and liberate nascent vesicles from the Golgi apparatus and plasma membrane.

DAPK Substrate Peptide

A4469-1 1 mg
EUR 292
Description: Synthetic peptide substrate for death associated protein kinase (DAPK) (Km = 9 ?M).