Apexbio Reagents Laboratories manufactures the glp-1 peptide apexbio reagents distributed by Genprice. The Glp-1 Peptide Apexbio reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact Apexbio Reagents. Other Glp-1 products are available in stock. Specificity: Glp-1 Category: Peptide Group: Apexbio
Anti-Inflammatory Peptide 1 |
ApexBio |
25 mg |
EUR 212 |
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I |
Anti-Inflammatory Peptide 1 |
ApexBio |
5 mg |
EUR 119 |
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I |
Amyloid ?-Peptide (1-42) (human) |
ApexBio |
100 ug |
EUR 276 |
HIV-1 Tat Protein Peptide |
ApexBio |
1 mg |
EUR 128 |
Description: HIV-1 Tat Protein Peptide |
HIV-1 Tat Protein Peptide |
ApexBio |
10 mg |
EUR 512 |
Description: HIV-1 Tat Protein Peptide |
Brain natriuretic peptide (1-32) (human) |
ApexBio |
1 mg |
EUR 518 |
Brain natriuretic peptide (1-32) (human) |
ApexBio |
10 mg |
EUR 2222 |
Apexbio information
Brain natriuretic peptide (1-32) (human) |
B5442-1 |
ApexBio |
1 mg |
EUR 518 |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
YAP-TEAD Inhibitor 1 (Peptide 17) |
A1149-1 |
ApexBio |
1 mg |
EUR 235 |
Glucagon-Like Peptide 2 (GLP-2) AssayMax ELISA Kit |
ERG3771-1 |
AssayPro |
96 Well Plate |
EUR 477 |
GnRH Associated Peptide (GAP) (1-13), human |
A1020-1 |
ApexBio |
1 mg |
EUR 90 |
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP). |
Glucagon-Like Peptide-1 (GLP) Antibody |
abx010841-100ul |
Abbexa |
100 ul |
EUR 411 |
- Shipped within 5-10 working days.
|
SAMS Peptide |
B5097-1 |
ApexBio |
1 mg |
EUR 222 |
Rhodopsin peptide |
A1087-1 |
ApexBio |
1 mg |
EUR 131 |
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light. |
C-type natriuretic peptide (1-22) (human, rat, swine) |
B5441-1 |
ApexBio |
1 mg |
EUR 276 |
Eledoisin-Related Peptide |
B5233-1 |
ApexBio |
1 mg |
EUR 155 |
MLCK inhibitor peptide |
B5236-1 |
ApexBio |
1 mg |
EUR 184 |
Lyn peptide inhibitor |
B5285-1 |
ApexBio |
1 mg |
EUR 601 |
Compstatin control peptide |
B5478-1 |
ApexBio |
1 mg |
EUR 373 |
c-JUN peptide |
B9007-1 |
ApexBio |
1 mg |
EUR 312 |
Cadherin Peptide, avian |
A1028-1 |
ApexBio |
1 mg |
EUR 102 |
Description: Cadherin Peptide, avian, (C44H75N17O13), a peptide with the sequence Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-NH2, MW= 1050.2. Cadherins (named for "calcium-dependent adhesion") are a class of type-1 transmembrane proteins. |
Dynamin inhibitory peptide |
A1046-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Dynamin Inhibitory Peptide is a peptide (Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro) inhibitor of the GTPase dynamin.Dynamin is a 100-kDa large GTPase that functions to tabulate membranes and liberate nascent vesicles from the Golgi apparatus and plasma membrane. |
DAPK Substrate Peptide |
A4469-1 |
ApexBio |
1 mg |
EUR 292 |
Description: Synthetic peptide substrate for death associated protein kinase (DAPK) (Km = 9 ?M). |